MOUSE ANTI HUMAN ZAP 70:Biotin Antibody

  • MOUSE ANTI HUMAN ZAP 70:Biotin Antibody

    CatalogueID : 1065008S

  • Contact Vendor

Target Zap 70
Host Species Mus musculus
Target Tag/Conjugate Biotin
Applications EIA
Clone SBZAP
Target Species Homo sapiens
Unit 25 µg
Cite This Product AbD Serotec cat# 1065008S RRID:AB_616708
Uniprot ID P43403
Clonality Monoclonal
Immunogen A KLH conjugated peptide PQRRIDTLNSDGYTPEPARITSPDKPRPMP corresponding to amino acid residues 280-309 of human ZAP70.
Isotype IgG1