RABBIT ANTI MOUSE INTERLEUKIN-21 RECEPTOR (N-TERMINAL) Antibody

  • RABBIT ANTI MOUSE INTERLEUKIN-21 RECEPTOR (N-TERMINAL) Antibody

    CatalogueID : AAM71

  • Contact Vendor

Target Interleukin-21 receptor
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications FC, IHC-P, EIA
Target Species Mus musculus
Unit 50 µg
Cite This Product AbD Serotec cat# AAM71 RRID:AB_2124131
Uniprot ID Q9JHX3
Clonality Polyclonal
Immunogen Synthetic peptide CVLETRSPNPSILSLTWQDEYEELQDQETF corresponding to amino acids 35-65 within the N-terminal region of mouse IL-21 receptor.
Isotype IgG
Form & Buffer Purified