Chicken Anti-RGS11 Polyclonal Antibody, Unconjugated

  • Contact Vendor

Target RGS11
Species Cross Reactivity Homo sapiens, Mus musculus, Rattus norvegicus
Host Species Gallus gallus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym AC004754.2, RS11
Unit 50 ug
Format 50 µg of immunogen affinity purified antibody in PBS.
NCBI Gene Aliases RS1
Company Thermo Scientific Pierce Antibodies
Clonality Polyclonal
Isotype IgY
Immunogen synthetic peptide FLKSDMYKALLAEAGIPLEMKRRVFPFTWRPRHSSPSPA, corresponding to amino acids 408-446 of Human RGS11.
Gene Name regulator of G-protein signaling 11