Chicken Anti-RGS6 Polyclonal Antibody, Unconjugated

  • Contact Vendor

Target RGS6
Species Cross Reactivity Homo sapiens, Mus musculus, Rattus norvegicus
Host Species Gallus gallus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym DKFZp313G1241, FLJ43552, GAP, MGC142132
Unit 50 ug
Format 50 µg of immunogen affinity purified antibody in PBS.
NCBI Gene Aliases DKFZp313G1241,FLJ43552,GAP,MGC14213, MGC14213, FLJ43552, DKFZp313G1241, GAP
Company Thermo Scientific Pierce Antibodies
Type Polyclonal
Isotype IgY
Immunogen synthetic peptide KSVYGVTEESQAQSPVHVLSQPIRKTTKEDIRKQI, corresponding to amino acids 231-265 of Human RGS6.
Gene Name regulator of G-protein signaling 6