Sheep Anti-CHX10 Polyclonal Antibody, Unconjugated

  • Contact Vendor

Target chx10
Species Cross Reactivity Bos taurus, Homo sapiens, Mus musculus, Rattus norvegicus
Host Species Ovis aries
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym CHX10, HOX10, MCOP2, MCOPCB3, RET1
Unit 250 ug
Format 250 µg of IgG antibody fraction in PBS with 0.08% sodium azide.
NCBI Gene Aliases HOX10, RET, CHX10, MCOPCB3, MCOP2, CHX10,HOX10,MCOP2,MCOPCB3,RET
Company Thermo Scientific Pierce Antibodies
Clonality Polyclonal
Isotype IgG
Immunogen Recombinant fragment: EAAAEKPEGERQALPKLDKMEQDERGPDAQAAISQEELRENSIAVLRAKAQEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAERLSPPQLEDMA, corresponding to C terminal amino acids 264-361 of Human CHX10.
Gene Name visual system homeobox 2