Chicken Anti-ICA1L Polyclonal Antibody, Unconjugated

  • Contact Vendor

Target Ica1l
Species Cross Reactivity Homo sapiens
Host Species Gallus gallus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym ALS2CR14, ALS2CR15, DKFZp434E1919, MGC138440
Unit 50 ug
Format 50 µg of immunogen affinity purified antibody in PBS.
NCBI Gene Aliases MGC13844, ALS2CR14,ALS2CR15,DKFZp434E1919,MGC13844, ALS2CR14, ALS2CR15, DKFZp434E1919
Company Thermo Scientific Pierce Antibodies
Type Polyclonal
Isotype IgY
Immunogen Fusion protein: levfhsvqetctellkiiekyqlrlnviseeenelglflkfqaerdatqagkmmdatgkalcssakqrlalctplsrlkqevatfsqravsdtlmt, corresponding to amino acids 53-148 of Human Ica69-related protein/LOC130026.
Gene Name islet cell autoantigen 1,69kDa-like