INCA (Human) Recombinant Protein (P01)

  • INCA (Human) Recombinant Protein (P01)

    from Abnova
    CatalogueID : H00440068-P01

  • Contact Vendor

Sequence MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS
Species Human
Additional Product Information

Stealth Micro Spotting Pins (Max.):
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Uniprot ID NP_001007233.1
Entrez GeneID 440068
Applications WB-Re,ELISA,Array,AP
Original Item Name INCA (Human) Recombinant Protein (P01)
Source/Expression System Recombinant
Molecule Name CARD17
Accession Number NP_001007233.1, NM_001007232.1
Type Protein
NCBI Gene Aliases INCA
NCBI Full Gene Name caspase recruitment domain family, member 17
Unit 10 ug,25 ug
Description Human INCA full-length ORF ( NP_001007233.1, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal