LOC285141 (Human) Recombinant Protein (P01)

  • LOC285141 (Human) Recombinant Protein (P01)

    from Abnova
    CatalogueID : H00285141-P01

  • Contact Vendor

Sequence METVNEPETGEVSKDAVIVKQEKNNEYCLQDIDDKLSESAEDDGEDDTNDEDDDEDSNPKKNTQAPLELMAEFLRAEMAREYQLAKKLCQMILIYEPENPEAKEFFTLIEEMLLMEKTQNHEQDGENSDEDSSGESKGESDEELSDESSDEGEDGS
Species Human
Additional Product Information

Stealth Micro Spotting Pins (Max.):
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Uniprot ID XP_209489.1
Entrez GeneID 285141
Applications WB-Re,ELISA,Array,AP
Source/Expression System Recombinant
Accession Number XP_209489.1, XM_209489.3
Original Item Name LOC285141 (Human) Recombinant Protein (P01)
Molecule Name LOC285141
Type Protein
Unit 10 ug,25 ug
Description Human LOC285141 full-length ORF ( XP_209489.1, 1 a.a. - 156 a.a.) recombinant protein with GST-tag at N-terminal