JDP2 (Human) Recombinant Protein (P01)

  • JDP2 (Human) Recombinant Protein (P01)

    from Abnova
    CatalogueID : H00122953-P01

  • Contact Vendor

Sequence MMPGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKRPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELKQERQQLILMLNRHRPTCIVRTDSVKTPESEGNPLLEQLEKK
Species Human
Additional Product Information

Stealth Micro Spotting Pins (Max.):
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Uniprot ID NP_569736.1
Entrez GeneID 122953
Applications WB-Re,ELISA,Array,AP
Source/Expression System Recombinant
Accession Number NP_569736.1, NM_130469.2
Molecule Name JDP2
Original Item Name JDP2 (Human) Recombinant Protein (P01)
Type Protein
NCBI Gene Aliases JUNDM2
NCBI Full Gene Name Jun dimerization protein 2
Unit 10 ug,25 ug
Description Human JDP2 full-length ORF ( NP_569736.1, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal