RABL4 (Human) Recombinant Protein (P01)

  • RABL4 (Human) Recombinant Protein (P01)

    from Abnova
    CatalogueID : H00011020-P01

  • Contact Vendor

Sequence MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKELFSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA
Species Human
Additional Product Information

Stealth Micro Spotting Pins (Max.):
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Uniprot ID AAH00566.1
Entrez GeneID 11020
Applications AP,WB-Re,ELISA,Array
Source/Expression System Recombinant
Accession Number AAH00566.1, BC000566.2
Original Item Name RABL4 (Human) Recombinant Protein (P01)
Molecule Name RABL4
Type Protein
NCBI Gene Aliases RABL4, RAYL
NCBI Full Gene Name intraflagellar transport 27 homolog (Chlamydomonas)
Unit 10 ug,25 ug
Description Human RABL4 full-length ORF ( AAH00566.1, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal