RING1 (Human) Recombinant Protein (P01)

  • RING1 (Human) Recombinant Protein (P01)

    from Abnova
    CatalogueID : H00006015-P01

  • Contact Vendor

Sequence MDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAPKRPRGGGAGGSSVGTGGGGTGGVGGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLALRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK
Species Human
Additional Product Information

Stealth Micro Spotting Pins (Max.):
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID 6015
Uniprot ID AAH02922.2
Applications AP,Array,ELISA,WB-Re
Accession Number BC002922.1, AAH02922.2
Molecule Name RING1
Source/Expression System Recombinant, in vitro Wheat Germ expression system
Original Item Name RING1 (Human) Recombinant Protein (P01)
Type Protein
NCBI Gene Aliases RING1A, RNF1
NCBI Full Gene Name ring finger protein 1
Unit 10 ug,25 ug
Description Human RING1 full-length ORF ( AAH02922.2, 1 a.a. - 377 a.a.) recombinant protein with GST-tag at N-terminal