Neuropeptide K (Porcine)

  • Neuropeptide K (Porcine)

    CatalogueID : 350287

  • Contact Vendor

Format Each vial contains 1 mg of lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Target/Molecule Synonym Neuropeptide K; NPK; Protachykinin-1; PPT; TAC1; NKA; NKNA; TAC2
Molecule Name Neuropeptide K
Original Item Name Neuropeptide K (Porcine)
Source/Expression System Synthetic
Purity Purity > 95% by HPLC
Molecular Weight 3980.6 g/mol
Formula C175H284N52O52S1
Uniprot ID Q60541
Sequence Porcine: H-Asp-Ala-Asp-Ser-Ser-Ile-Glu-Lys-Gln-Val-Ala-Leu-Leu-Lys-Ala-Leu-Tyr-Gly-His-Gly-Gln-Ile-Ser-His-Lys-Arg-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 or H-DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM-NH2
Unit 1 mg
Description Neuropeptide K belongs to the tachykinin family. These active peptides excite neurons, provoke behaviorial responses, and are potent vasodilators and secretagogues