SPRR2G (Human) Recombinant Protein (P01)

  • SPRR2G (Human) Recombinant Protein (P01)

    from Abnova
    CatalogueID : H00006706-P01

  • Contact Vendor

Sequence MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQPYPPCQQKYPPKSK
Species Human
Additional Product Information

Stealth Micro Spotting Pins (Max.):
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Uniprot ID NP_001014313.1
Entrez GeneID 6706
Applications AP,Array,ELISA,WB-Re
Original Item Name SPRR2G (Human) Recombinant Protein (P01)
Source/Expression System Recombinant
Molecule Name SPRR2G
Accession Number NP_001014313.1, NM_001014291.2
Type Protein
NCBI Full Gene Name small proline-rich protein 2G
Unit 10 ug,25 ug
Description Human SPRR2G full-length ORF ( NP_001014313.1, 1 a.a. - 73 a.a.) recombinant protein with GST-tag at N-terminal