IL21 (Human) Recombinant Protein (P01)

  • IL21 (Human) Recombinant Protein (P01)

    from Abnova
    CatalogueID : H00059067-P01

  • Contact Vendor

Sequence MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Species Human
Additional Product Information

Stealth Micro Spotting Pins (Max.):
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Uniprot ID NP_001001551.1
Entrez GeneID 59067
Applications WB-Re,ELISA,Array,AP
Accession Number NM_021803.1, NP_068575.1
Source/Expression System Recombinant
Molecule Name IL21
Original Item Name IL21 (Human) Recombinant Protein (P01)
Type Protein
NCBI Gene Aliases Za11, IL-21
NCBI Full Gene Name interleukin 21
Unit 2 ug
Description Human C9orf103 full-length ORF ( NP_068575.1, 1 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal