MIER1 (Human) Recombinant Protein (P01)

  • MIER1 (Human) Recombinant Protein (P01)

    from Abnova
    CatalogueID : H00057708-P01

  • Contact Vendor

Sequence MMEGETNFSSEIEDLAREGDMPIHELLSLYGYGSTVRLPEEDEEEEEEEEEGEDDEDADNDDNSGCSGENKEENIKDSSGQEDETQSSNDDPSQSVASQDAQEIIRPRRCKYFDTNSEVEEESEEDEDYIPSEDWKKEIMVGSMFQAEIPVGICRY
Species Human
Additional Product Information

Stealth Micro Spotting Pins (Max.):
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Uniprot ID AAH17423.1
Entrez GeneID 57708
Applications WB-Re,ELISA,Array,AP
Original Item Name MIER1 (Human) Recombinant Protein (P01)
Accession Number BC017423.1, AAH17423.1
Source/Expression System Recombinant
Molecule Name MIER1
Type Protein
NCBI Gene Aliases DKFZp781G0451, ER1, KIAA1610, MGC131940, MGC150640, MGC150641, MI-ER1, hMI-ER1
NCBI Full Gene Name mesoderm induction early response 1 homolog (Xenopus laevis)
Unit 2 ug
Description Human MIER1 full-length ORF ( AAH17423.1, 1 a.a. - 156 a.a.) recombinant protein with GST-tag at N-terminal