CHRNA1 (Human) Recombinant Protein (Q01)

  • CHRNA1 (Human) Recombinant Protein (Q01)

    from Abnova
    CatalogueID : H00001134-Q01

  • Contact Vendor

Sequence SYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRLP
Uniprot ID NP_000070.1
Entrez GeneID 1134
Applications AP,WB-Re,ELISA,Array
Molecule Name CHRNA1
Original Item Name CHRNA1 (Human) Recombinant Protein (Q01)
Species Human
Accession Number NM_000079, NP_000070.1
Source/Expression System Recombinant
Type Protein
NCBI Gene Aliases FCCMS, SCCMS, CMS2A, CHRNA, ACHRA, ACHRD
NCBI Full Gene Name cholinergic receptor, nicotinic, alpha 1 (muscle)
Unit 10 ug,25 ug
Description Human CHRNA1 partial ORF ( NP_000070.1, 146 a.a. - 231 a.a.) recombinant protein with GST-tag at N-terminal