SF3B4 (Human) Recombinant Protein (Q01)

  • SF3B4 (Human) Recombinant Protein (Q01)

    from Abnova
    CatalogueID : H00010262-Q01

  • Contact Vendor

Sequence ATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSA
Uniprot ID NP_005841.1
Entrez GeneID 10262
Applications AP,Array,ELISA,WB-Re
Species Human
Accession Number NM_005850, NP_005841.1
Source/Expression System Recombinant
Molecule Name SF3B4
Original Item Name SF3B4 (Human) Recombinant Protein (Q01)
Type Protein
NCBI Gene Aliases SAP49, Hsh49, SF3b49, MGC10828
NCBI Full Gene Name splicing factor 3b, subunit 4, 49kDa
Unit 10 ug,25 ug
Description Human SF3B4 partial ORF ( NP_005841.1, 13 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal