MFAP3 (Human) Recombinant Protein (P01)

  • MFAP3 (Human) Recombinant Protein (P01)

    from Abnova
    CatalogueID : H00004238-P01

  • Contact Vendor

Sequence MKLHCCLFTLVASIIVPAAFVLEDVDFDQMVSLEANRSSYNASFPSSFELSASSHSDDDVIIAKEGTSVSIECLLTASHYEDVHWHNSKGQQLDGRSRGGKWLVSDNFLNITNVAFDDRGLYTCFVTSPIRASYSVTLRVIFTSGDMSVYYMIVCLIAFTITLILNVTRLCMMSSHLRKTEKAINEFFRTEGAEKLQKAFEIAKRIPIITSAKTLELAKVTQFKTMEFARYIEELARSVPLPPLILNCRAFVEEMFEAVRVDDPDDLGERIKERPALNAQGGIYVINPEMGRSNSPGGDSDDGSLNEQGQEIAVQVSVHLQSETKSIDTESQGSSHFSPPDDIGSAESNCNYKDGAYENCQL
Species Human
Additional Product Information

Stealth Micro Spotting Pins (Max.):
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Uniprot ID NP_005918.1
Entrez GeneID 4238
Original Item Name MFAP3 (Human) Recombinant Protein (P01)
Applications AP,WB-Re,ELISA,Array
Accession Number NP_005918.1, NM_005927.3
Source/Expression System Recombinant
Molecule Name MFAP3
Type Protein
NCBI Gene Aliases DKFZp586F0219
NCBI Full Gene Name microfibrillar-associated protein 3
Unit 10 ug,25 ug
Description Human MFAP3 full-length ORF ( NP_005918.1, 1 a.a. - 362 a.a.) recombinant protein with GST-tag at N-terminal