ZNF365 (Human) Recombinant Protein (P01)

  • ZNF365 (Human) Recombinant Protein (P01)

    from Abnova
    CatalogueID : H00022891-P01

  • Contact Vendor

Sequence MDLHADSLDGTRSGPGLPTSDTKASFEAHVREKFNRMVEAVDRTVEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALNRQVDVAVEMIAVLRQRLTESEEELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLLQRVELAEKQLEYYQSQQASGFVRDLSGHVLTDISSNRKPKCLSRGHPHSVCNHPDLKSHFHPKGRNHLKKAKDDRASMQPAKAIHEQAESSRDLCRPPKKGELLGFGRKGNIRPKMAKKKPTAIVNII
Species Human
Additional Product Information

Stealth Micro Spotting Pins (Max.):
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID 22891
Uniprot ID AAH70073.1
Applications AP,WB-Re,Array,ELISA
Original Item Name ZNF365 (Human) Recombinant Protein (P01)
Accession Number BC070073.1, AAH70073.1
Molecule Name ZNF365
Source/Expression System Recombinant
Type Protein
NCBI Gene Aliases KIAA0844, MGC41821, MGC87345, Su48, UAN, ZNF365D
NCBI Full Gene Name zinc finger protein 365
Unit 2 ug
Description Human ZNF365 full-length ORF ( AAH70073.1, 1 a.a. - 276 a.a.) recombinant protein with GST-tag at N-terminal