NID2 (Human) Recombinant Protein (Q01)

  • NID2 (Human) Recombinant Protein (Q01)

    from Abnova
    CatalogueID : H00022795-Q01

  • Contact Vendor

Sequence PNGLTFDPFSKLLCWADAGTKKLECTLPDGTGRRVIQNNLKYPFSIVSYADHFYHTDWRRDGVVSVNKHSGQFTDEYLPEQRSHLYGITAVYPYCPTGRK
Uniprot ID NP_031387.2
Entrez GeneID 22795
Applications AP,WB-Re,Array,ELISA
Source/Expression System Recombinant
Species Human
Accession Number NM_007361, NP_031387.2
Original Item Name NID2 (Human) Recombinant Protein (Q01)
Molecule Name NID2
Type Protein
NCBI Gene Aliases NID-2
NCBI Full Gene Name nidogen 2 (osteonidogen)
Unit 10 ug,25 ug
Description Human NID2 partial ORF ( NP_031387.2, 1276 a.a. - 1375 a.a.) recombinant protein with GST-tag at N-terminal