CRTC1 (Human) Recombinant Protein (Q01)

  • CRTC1 (Human) Recombinant Protein (Q01)

    from Abnova
    CatalogueID : H00023373-Q01

  • Contact Vendor

Sequence ASHSGIPNIILTVTGESPPSLSKELTSSLAGVGDVSFDSDSQFPLDELKIDPLTLDGLHMLNDPDMVLADPATEDTFRMDRL
Uniprot ID NP_056136.1
Entrez GeneID 23373
Applications AP,WB-Re,Array,ELISA
Source/Expression System Recombinant
Species Human
Original Item Name CRTC1 (Human) Recombinant Protein (Q01)
Accession Number NP_056136.1, NM_015321
Molecule Name CRTC1
Type Protein
NCBI Gene Aliases FLJ14027, KIAA0616, TORC1, WAMTP1, MECT1
NCBI Full Gene Name CREB regulated transcription coactivator 1
Unit 10 ug,25 ug
Description Human CRTC1 partial ORF ( NP_056136.1, 553 a.a. - 634 a.a.) recombinant protein with GST-tag at N-terminal