EXOSC7 (Human) Recombinant Protein (Q01)

  • EXOSC7 (Human) Recombinant Protein (Q01)

    from Abnova
    CatalogueID : H00023016-Q01

  • Contact Vendor

Sequence LSVENVPCIVTLCKIGYRHVVDATLQEEACSLASLLVSVTSKGVVTCMRKVGKGSLDPESIFEMMETGKRVGKVLHASLQSVLHKEESLGPKRQKVGFLG
Entrez GeneID 23016
Uniprot ID NP_055819.1
Applications AP,WB-Re,Array,ELISA
Molecule Name EXOSC7
Source/Expression System Recombinant
Accession Number NM_015004, NP_055819.1
Original Item Name EXOSC7 (Human) Recombinant Protein (Q01)
Species Human
Type Protein
NCBI Gene Aliases Rrp42p, hRrp42p, FLJ26543, RRP42, EAP1, p8, KIAA0116
NCBI Full Gene Name exosome component 7
Unit 10 ug,25 ug
Description Human EXOSC7 partial ORF ( NP_055819.1, 192 a.a. - 291 a.a.) recombinant protein with GST-tag at N-terminal