RPL13 (Human) Recombinant Protein (P01)

  • RPL13 (Human) Recombinant Protein (P01)

    from Abnova
    CatalogueID : H00006137-P01

  • Contact Vendor

Sequence MAPSRNGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARHIAPRPASGPIRPIVRCPTVRYHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAKEAAEQDVEKKK
Entrez GeneID 6137
Uniprot ID AAH13078
Applications AP,Array,ELISA,WB-Re
Original Item Name RPL13 (Human) Recombinant Protein (P01)
Source/Expression System Recombinant
Molecule Name RPL13
Accession Number BC013078, AAH13078
Species Human
Type Protein
NCBI Gene Aliases BBC1, D16S444E, FLJ27453, FLJ27454, L13, MGC117342, MGC71373
NCBI Full Gene Name ribosomal protein L13
Unit 10 ug,25 ug
Description Human RPL13 full-length ORF ( AAH13078, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal