CA8 (Human) Recombinant Protein (P01)

  • CA8 (Human) Recombinant Protein (P01)

    from Abnova
    CatalogueID : H00000767-P01

  • Contact Vendor

Sequence MADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
Species Human
Additional Product Information

Stealth Micro Spotting Pins (Max.):
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID 767
Uniprot ID NP_004047.3
Applications AP,WB-Re,ELISA,Array
Source/Expression System Recombinant
Original Item Name CA8 (Human) Recombinant Protein (P01)
Molecule Name CA8
Accession Number NM_004056.4, NP_004047.3
Type Protein
NCBI Gene Aliases CARP, CALS, MGC120502, CA-VIII, CAMRQ3, MGC99509
NCBI Full Gene Name carbonic anhydrase VIII
Unit 10 ug,25 ug
Description Human CA8 full-length ORF ( NP_004047.3, 1 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal