LYZL6 (Human) Recombinant Protein (P01)

  • LYZL6 (Human) Recombinant Protein (P01)

    from Abnova
    CatalogueID : H00057151-P01

  • Contact Vendor

Sequence MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSFDYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRPLFYWLTGCRLR
Species Human
Additional Product Information

Stealth Micro Spotting Pins (Max.):
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Uniprot ID NP_065159.1
Entrez GeneID 57151
Applications WB-Re,ELISA,Array,AP
Accession Number NM_020426.1, NP_065159.1
Molecule Name LYZL6
Source/Expression System Recombinant
Original Item Name LYZL6 (Human) Recombinant Protein (P01)
Type Protein
NCBI Gene Aliases PRO1485, LYC1, TKAL754, UNQ754
NCBI Full Gene Name lysozyme-like 6
Unit 10 ug,25 ug
Description Human LYZL6 full-length ORF ( NP_065159.1, 1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal