HRASLS (Human) Recombinant Protein (P01)

  • HRASLS (Human) Recombinant Protein (P01)

    from Abnova
    CatalogueID : H00057110-P01

  • Contact Vendor

Sequence MAFNDCFSLNYPGNPCPGDLIEVFRPGYQHWALYLGDGYVINIAPVDGIPASFTSAKSVFSSKALVKMQLLKDVVGNDTYRINNKYDETYPPLPVEEIIKRSEFVIGQEVAYNLLVNNCEHFVTLLRYGEGVSEQANRAISTVEFVTAAVGVFSFLGLFPKGQRAKYY
Species Human
Additional Product Information

Stealth Micro Spotting Pins (Max.):
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Uniprot ID NP_065119.1
Entrez GeneID 57110
Applications WB-Re,ELISA,Array,AP
Accession Number NM_020386.2, NP_065119.1
Molecule Name HRASLS
Source/Expression System Recombinant
Original Item Name HRASLS (Human) Recombinant Protein (P01)
Type Protein
NCBI Gene Aliases A-C1, H-REV107, HRASLS1, HSD28
NCBI Full Gene Name HRAS-like suppressor
Unit 10 ug,25 ug
Description Human HRASLS full-length ORF ( NP_065119.1, 1 a.a. - 168 a.a.) recombinant protein with GST-tag at N-terminal