JAM3 (Human) Recombinant Protein (P01)

  • JAM3 (Human) Recombinant Protein (P01)

    from Abnova
    CatalogueID : H00083700-P01

  • Contact Vendor

Sequence MALRRPPRLRLCARLPDFFLLLLFRGCLIGAVNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLNIGGIIGGVLVVLAVLALITLGICCAYRRGYFINNKQDGESYKNPGKPDGVNYIRTDEEGDFRHKSSFVI
Species Human
Additional Product Information

Stealth Micro Spotting Pins (Max.):
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID 83700
Uniprot ID AAH12147.1
Molecule Name JAM3
Source/Expression System Recombinant
Applications WB-Re,ELISA,Array,AP
Original Item Name JAM3 (Human) Recombinant Protein (P01)
Accession Number BC012147.1, AAH12147.1
Type Protein
NCBI Gene Aliases FLJ14529, JAM-C, JAMC
NCBI Full Gene Name junctional adhesion molecule 3
Unit 10 ug,25 ug
Description Human JAM3 full-length ORF ( AAH12147.1, 1 a.a. - 310 a.a.) recombinant protein with GST-tag at N-terminal