WT1 (Human) Recombinant Protein (Q01)

  • WT1 (Human) Recombinant Protein (Q01)

    from Abnova
    CatalogueID : H00007490-Q01

  • Contact Vendor

Sequence QDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTC
Entrez GeneID 7490
Uniprot ID NP_000369.3
Applications AP,Array,WB-Re,ELISA
Source/Expression System Recombinant
Species Human
Molecule Name WT1
Original Item Name WT1 (Human) Recombinant Protein (Q01)
Accession Number NM_000378, NP_000369.3
Type Protein
NCBI Gene Aliases WIT-2, GUD, WT33, AWT1, NPHS4, WAGR
NCBI Full Gene Name Wilms tumor 1
Unit 10 ug,25 ug
Description Human WT1 partial ORF ( NP_000369.3, 349 a.a. - 439 a.a.) recombinant protein with GST-tag at N-terminal