MLL2 (Human) Recombinant Protein (Q01)

  • MLL2 (Human) Recombinant Protein (Q01)

    from Abnova
    CatalogueID : H00008085-Q01

  • Contact Vendor

Sequence SKLEGMFPAYLQEAFFGKELLDLSRKALFAVGVGRPSFGLGTPKAKGDGGSERKELPTSQKGDDGPDIADEESRGLEGKADTPGPEDGGVKASPVPSDPE
Uniprot ID NP_003473.1
Entrez GeneID 8085
Applications AP,WB-Re,ELISA,Array
Accession Number NM_003482, NP_003473.1
Molecule Name MLL2
Source/Expression System Recombinant
Species Human
Original Item Name MLL2 (Human) Recombinant Protein (Q01)
Type Protein
NCBI Gene Aliases KMT2B, KMT2D, TNRC21, AAD10, CAGL114, MLL4, ALR
NCBI Full Gene Name myeloid/lymphoid or mixed-lineage leukemia 2
Unit 10 ug,25 ug
Description Human MLL2 partial ORF ( NP_003473.1, 1487 a.a. - 1586 a.a.) recombinant protein with GST-tag at N-terminal