CACNG7 (Human) Recombinant Protein (Q01)

  • CACNG7 (Human) Recombinant Protein (Q01)

    from Abnova
    CatalogueID : H00059284-Q01

  • Contact Vendor

Sequence RYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRGRSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSP
Entrez GeneID 59284
Uniprot ID NP_114102.2
Applications WB-Re,ELISA,Array,AP
Molecule Name CACNG7
Original Item Name CACNG7 (Human) Recombinant Protein (Q01)
Source/Expression System Recombinant
Species Human
Accession Number NP_114102.2, NM_031896
Type Protein
NCBI Full Gene Name calcium channel, voltage-dependent, gamma subunit 7
Unit 10 ug,25 ug
Description Human CACNG7 partial ORF ( NP_114102.2, 203 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal