GM2A (Human) Recombinant Protein (P01)

  • GM2A (Human) Recombinant Protein (P01)

    from Abnova
    CatalogueID : H00002760-P01

  • Contact Vendor

Sequence MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI
Species Human
Additional Product Information

Stealth Micro Spotting Pins (Max.):
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID 2760
Uniprot ID NP_000396.2
Source/Expression System Recombinant
Original Item Name GM2A (Human) Recombinant Protein (P01)
Applications AP,WB-Re,ELISA,Array
Accession Number NP_000396.2, NM_000405.3
Molecule Name GM2A
Type Protein
NCBI Gene Aliases SAP-3, GM2-AP
NCBI Full Gene Name GM2 ganglioside activator
Unit 10 ug,25 ug
Description Human GM2A full-length ORF ( NP_000396.2, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal