MOBKL1A (Human) Recombinant Protein (P01)

  • MOBKL1A (Human) Recombinant Protein (P01)

    from Abnova
    CatalogueID : H00092597-P01

  • Contact Vendor

Sequence MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR
Species Human
Additional Product Information

Stealth Micro Spotting Pins (Max.):
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID 92597
Uniprot ID NP_775739.1
Source/Expression System Recombinant
Original Item Name MOBKL1A (Human) Recombinant Protein (P01)
Applications WB-Re,ELISA,Array,AP
Accession Number NM_173468.2, NP_775739.1
Molecule Name MOBKL1A
Type Protein
NCBI Gene Aliases MGC33910, MOB4A, MATS2, Mob1B
NCBI Full Gene Name MOB1, Mps One Binder kinase activator-like 1A (yeast)
Unit 10 ug,25 ug
Description Human MOBKL1A full-length ORF ( NP_775739.1, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal