CRHBP (Human) Recombinant Protein (P02)

  • CRHBP (Human) Recombinant Protein (P02)

    from Abnova
    CatalogueID : H00001393-P02

  • Contact Vendor

Sequence MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL
Species Human
Additional Product Information

Stealth Micro Spotting Pins (Max.):
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID 1393
Uniprot ID NP_001873.2
Applications AP,WB-Re,ELISA,Array
Source/Expression System Recombinant
Molecule Name CRHBP
Accession Number NM_001882.3, NP_001873.2
Original Item Name CRHBP (Human) Recombinant Protein (P02)
Type Protein
NCBI Gene Aliases CRF-BP, CRFBP
NCBI Full Gene Name corticotropin releasing hormone binding protein
Unit 10 ug,25 ug
Description Human CRHBP full-length ORF ( NP_001873.2, 1 a.a. - 322 a.a.) recombinant protein with GST-tag at N-terminal