CTLA4 (Human) Recombinanat Protein

  • CTLA4 (Human) Recombinanat Protein

    from Abnova
    CatalogueID : P4933

  • Contact Vendor

Original Item Name CTLA4 (Human) Recombinanat Protein
Sequence CTLA4 mature: mhvaqpavvlassrgiasfvceyaspgkatevrvtvlrqadsqvtevcaatymtgneltflddsictgtssgnqvnltiqglramdtglyickvelmypppyylgigngtqiyvidpepcpdsdf
Fused to murine IgG2a Fc: eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk
Concentration 0.5 mg/mL
Molecule Name CTLA4
Entrez GeneID 1493
Format Liquid
Species Human
Applications SDS-PAGE
Type Protein
NCBI Gene Aliases CD, CD152, CELIAC3, CTLA-4, GRD4, GSE, ICOS, IDDM12
NCBI Full Gene Name cytotoxic T-lymphocyte-associated protein 4
Unit 25 ug
Description Human CTLA4 recombinant protein fused to murine IgG2a Fc purified from CHO cells