Cd40lg (Mouse) Recombinant Protein

  • Cd40lg (Mouse) Recombinant Protein

    from Abnova
    CatalogueID : P4590

  • Contact Vendor

Original Item Name Cd40lg (Mouse) Recombinant Protein
Sequence MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL
Entrez GeneID 21947
Applications Func,SDS-PAGE
Format Lyophilized
Species Mouse
Molecule Name Cd40lg
Accession Number P27548
Type Protein
NCBI Gene Aliases CD154, CD40-L, Cd40l, HIGM1, IGM, IMD3, Ly-62, Ly62, T-BAM, TRAP, Tnfsf5, gp39
NCBI Full Gene Name CD40 ligand
Unit 25 ug
Description Mouse Cd40lg (P27548) recombinant protein expressed in Escherichia coli