PAX7 (Human) Recombinant Protein (Q02)

  • PAX7 (Human) Recombinant Protein (Q02)

    from Abnova
    CatalogueID : H00005081-Q02

  • Contact Vendor

Accession Number NM_002584, NP_001128726.1
Entrez GeneID 5081
Species Human
Applications WB-Re,ELISA,Array,AP
Sequence AYGARHSFSSYSDSFMNPAAPSNHMNPVSNGLSPQVMSILGNPSAVPPQPQADFSISPLHGGLDSATSISASCSQRADSIKPGD
Original Item Name PAX7 (Human) Recombinant Protein (Q02)
Molecule Name PAX7
Type Protein
NCBI Gene Aliases HUP1, RMS2, FLJ37460, PAX7B
NCBI Full Gene Name paired box 7
Unit 10 ug,25 ug
Description Human PAX7 partial ORF (NP_001128726.1, 351 a.a. - 434 a.a.) recombinant protein with GST tag at N-terminal