RIC8A (Human) Recombinant Protein (Q01)

  • RIC8A (Human) Recombinant Protein (Q01)

    from Abnova
    CatalogueID : H00060626-Q01

  • Contact Vendor

Sequence VTGRVEEKPPNPMEGMTEEQKEHEAMKLVTMFDKLSRNRVIQPMGMSPRGHLTSLQDAMCETMEQQLSSDPDS
Entrez GeneID 60626
Uniprot ID NP_068751.4
Applications WB-Re,ELISA,Array,AP
Molecule Name RIC8A
Original Item Name RIC8A (Human) Recombinant Protein (Q01)
Accession Number NP_068751.4, NM_021932
Species Human
Source/Expression System Recombinant
Type Protein
NCBI Gene Aliases MGC104517, MGC131931, MGC148073, MGC148074, RIC8
NCBI Full Gene Name resistance to inhibitors of cholinesterase 8 homolog A (C. elegans)
Unit 10 ug,25 ug
Description Human RIC8A partial ORF ( NP_068751.4, 462 a.a. - 534 a.a.) recombinant protein with GST-tag at N-terminal