FGF16 (Human) Recombinant Protein (P01)

  • FGF16 (Human) Recombinant Protein (P01)

    from Abnova
    CatalogueID : H00008823-P01

  • Contact Vendor

Sequence MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR
Species Human
Additional Product Information

Stealth Micro Spotting Pins (Max.):
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID 8823
Uniprot ID NP_003859.1
Source/Expression System Recombinant
Accession Number NM_003868.1, NP_003859.1
Molecule Name FGF16
Applications AP,WB-Re,Array,ELISA
Original Item Name FGF16 (Human) Recombinant Protein (P01)
Type Protein
NCBI Gene Aliases FGF-16
NCBI Full Gene Name fibroblast growth factor 16
Unit 10 ug,25 ug
Description Human FGF16 full-length ORF ( NP_003859.1, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal