Pyruvate Kinase Antibody

  • Contact Vendor

Target Pklr
Species Cross Reactivity Canis lupus familiaris, Caenorhabditis elegans, Rattus norvegicus, Mus musculus, Bos taurus, Homo sapiens, Xenopus laevis
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym EC 2.7.1.40, PKL, PKR, PK1PKRL, pyruvate kinase type L, pyruvate kinase, liver and blood cell, pyruvate kinase, liver and RBC, Pyruvate kinase 1, pyruvate kinase isozyme R/L, pyruvate kinase isozymes R/L, Red cell/liver pyruvate kinase, RPK, R-type/L-type pyruvate kinase
Unit 0.1 mg
Format Protein A purified
Concentration LYOPH
NCBI Gene Aliases PK1, PKL, PKR, PKRL, RPK
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to PKLR(pyruvate kinase, liver and RBC) The peptide sequence was selected from the N terminal of PKLR (NP_870986). Peptide sequence STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE