Pyruvate Kinase Antibody

  • Contact Vendor

Target Pklr
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC-P, WB
Target Species Homo sapiens
Target/Molecule Synonym EC 2.7.1.40, PKL, PKR, PK1PKRL, pyruvate kinase isozymes R/L, pyruvate kinase type L, pyruvate kinase, liver and blood cell, pyruvate kinase, liver and RBC, Pyruvate kinase 1, pyruvate kinase isozyme R/L, Red cell/liver pyruvate kinase, RPK, R-type/L-type pyruvate kinase
Unit 100 ul
Format Affinity purified
NCBI Gene Aliases PK1,PKL,PKR,PKRL,RP
Company Novus Biologicals
Isotype IgG
Immunogen Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LFEELRRAAPLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLS
Gene Name pyruvate kinase, liver and RBC