RBCK1 Antibody

  • Contact Vendor

Target rbck1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym C20orf18, EC 6.3.2.-, HBV associated factor 4, Hepatitis B virus X-associated protein 4, Heme-oxidized IRP2 ubiquitin ligase 1, HBV-associated factor 4, HOIL-1, RanBP-type and C3HC4-type zinc finger containing 1, ranBP-type and C3HC4-type zinc finger-containing protein 1, RBCC protein interacting with PKC1, RBCK2, RNF54RING finger protein 54, Ubiquitin-conjugating enzyme 7-interacting protein 3, UBCE7IP3HOIL1, ubiquitin conjugating enzyme 7 interacting protein 3, XAP3, XAP4chromosome 20 open reading frame 18, ZRANB4
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases C20orf18, HOIL-1, HOIL1, RBCK2, RNF54, UBCE7IP3, XAP3, XAP4, ZRANB4
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEP