RBM11 Antibody

  • Contact Vendor

Target Rbm11
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym putative gene, RNA binding motif protein 11 like10putative RNA-binding protein 11, RNA binding motif protein 11, RNA-binding motif protein 11
Unit 0.1 ml
Format Immunogen affinity purified
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LYGRPINVQYRFGSSRSSEPANQSFESCVKINSHNYRNEEMLVGRSSFPMQYFPINNTSLP