RBM11 Antibody

  • Contact Vendor

Target Rbm11
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym putative gene, RNA binding motif protein 11 like10putative RNA-binding protein 11, RNA binding motif protein 11, RNA-binding motif protein 11
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RBM11 (RNA binding motif protein 11) The peptide sequence was selected from the middle region of RBM11. Peptide sequence SLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNR