RBM4B Antibody

  • Contact Vendor

Target Rbm4b
Species Cross Reactivity Canis lupus familiaris, Sus scrofa, Oryctolagus cuniculus, Rattus norvegicus, Mus musculus, Bos taurus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym MGC10871, RBM30, RBM4L, RNA binding motif protein 30, RNA binding motif protein 4B, RNA-binding motif protein 30, RNA-binding motif protein 4B, RNA-binding protein 30, RNA-binding protein 4B, ZCCHC15, ZCRB3B, zinc finger CCHC-type and RNA binding motif 3B
Unit 0.1 mg
Format IgG purified
Concentration LYOPH
NCBI Gene Aliases MGC10871, RBM30, RBM4L, ZCCHC15, ZCRB3B
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptide directed towards the C terminal of human RBM4B. Peptide sequence AAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSL