RBMS3 Antibody

  • Contact Vendor

Target RBMS3
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target/Molecule Synonym RNA binding motif, single stranded interacting protein 3, RNA-binding protein, single stranded interacting protein, single-stranded-interacting protein 3
Unit 100 ug
Format IgG purified
Concentration LYOPH mg/ml
NCBI Gene Aliases FLJ3654
Company Novus Biologicals
Immunogen Synthetic peptides corresponding to RBMS3 (RNA binding motif, single stranded interacting protein) The peptide sequence was selected from the C terminal of RBMS3 . Peptide sequence TAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSKP.
Gene Name RNA binding motif, single stranded interacting protein 3