RBMS3 Antibody

  • Contact Vendor

Target RBMS3
Species Cross Reactivity Canis lupus familiaris, Mus musculus, Bos taurus, Gallus gallus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym RNA binding motif, single stranded interacting protein 3, RNA-binding protein, single stranded interacting protein, single-stranded-interacting protein 3
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases FLJ36544
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RBMS3(RNA binding motif, single stranded interacting protein) The peptide sequence was selected from the middle region of RBMS3. Peptide sequence PTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSK