RBMS3 Antibody

  • Contact Vendor

Target RBMS3
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym RNA binding motif, single stranded interacting protein 3, RNA-binding protein, single stranded interacting protein, single-stranded-interacting protein 3
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ36544
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MNHLSLGTTGTIQSQDRIMILHQLLCQYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQI