hnRNP G Antibody

  • Contact Vendor

Target RBMX
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym Glycoprotein p43, heterogeneous nuclear ribonucleoprotein G, HNRPG, hnRNP G, hnRNP-G, RBMXP1, RBMXRT, RNA binding motif protein, X chromosome, RNA binding motif protein, X-linked, RNA-binding motif protein, X chromosome, RNMX
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases HNRPG, RBMXP1, RBMXRT, RNMX, hnRNP-G
Company Novus Biologicals
Type Antibody
Immunogen The specific Immunogen is proprietary information. Peptide sequence SSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDS