SF4 Antibody

  • Contact Vendor

Target Sugp1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym DKFZp434E2216, F23858, SF4RNA-binding protein RBP, Splicing factor 4RBP, SURP and G patch domain containing 1, SURP and G-patch domain-containing protein 1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DKFZp434E2216, F23858, RBP, SF4
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKMEQKAKQNQVASPQPPHPGEITNAHNSSCISNKFANDGSFLQQFLKLQKAQTSTDAPTSAPSAPPSTPT