SF4 Antibody

  • Contact Vendor

Target Sugp1
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym DKFZp434E2216, F23858, SF4RNA-binding protein RBP, Splicing factor 4RBP, SURP and G patch domain containing 1, SURP and G-patch domain-containing protein 1
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases DKFZp434E2216, F23858, RBP, SF4
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to SF4(splicing factor 4) The peptide sequence was selected from the N terminal of SF4. Peptide sequence MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKM